Structure of PDB 5l2l Chain A Binding Site BS03

Receptor Information
>5l2l Chain A (length=72) Species: 1294386 (Saccharomyces cerevisiae YJM1574) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINED
CRFGVNCKNIYCLFRHPPGRVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l2l Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		C415 F417 N423 K424 R425 Y428
Binding residue
(residue number reindexed from 1)		C8 F10 N16 K17 R18 Y21
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5l2l, PDBe:5l2l, PDBj:5l2l
PDBsum5l2l
PubMed28180315
UniProtP32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 (Gene Name=NAB2)

[Back to BioLiP]