Structure of PDB 5jgh Chain A Binding Site BS03

Receptor Information
>5jgh Chain A (length=156) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKI
AGEKWQNLEADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPAGPFIKY
ANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEY
NARYPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jgh DNA structure directs positioning of the mitochondrial genome packaging protein Abf2p.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R45 S48 Y50 F51 S74 K75 W81 Q82 R96 Y100
Binding residue
(residue number reindexed from 1)
R19 S22 Y24 F25 S48 K49 W55 Q56 R70 Y74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5jgh, PDBe:5jgh, PDBj:5jgh
PDBsum5jgh
PubMed27899643
UniProtQ02486|ABF2_YEAST ARS-binding factor 2, mitochondrial (Gene Name=ABF2)

[Back to BioLiP]