Structure of PDB 5flv Chain A Binding Site BS03

Receptor Information

>5flv Chain A (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRR
YKGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKY
ILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMR
QLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADSTHVFPETAFI
AVTSYQNHKITQLKIENNPFAKGFRG

Ligand information

>5flv Chain O (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

accacttcaaaggtgtgagaag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5flv Complex Interdependence Regulates Heterotypic Transcription Factor Distribution and Coordinates Cardiogenesis.
Resolution	3.005 Å
Binding residue (original residue number in PDB)	K1055 R1061
Binding residue (residue number reindexed from 1)	K55 R61
Binding affinity	PDBbind-CN: Kd~50nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5flv, PDBe:5flv, PDBj:5flv
PDBsum	5flv
PubMed	26875865
UniProt	P42582; P70326

[Back to BioLiP]