Structure of PDB 5fdg Chain A Binding Site BS03

Receptor Information

>5fdg Chain A (length=181) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1)))

GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVC
FMYSDASKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKEN
RFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDE
ESRARIKTRLFTIRQEMASRGLWDSFRQSER

Ligand information

• Ligand ID: 0N8
• InChI: InChI=1S/C23H24ClNO4/c24-19-8-6-17(7-9-19)15-23(21(27)14-20(26)22(28)29)10-12-25(13-11-23)16-18-4-2-1-3-5-18/h1-9,14,26H,10-13,15-16H2,(H,28,29)/b20-14-
• InChIKey: DGJZJCIAWLMRBY-ZHZULCJRSA-N
• SMILES:
  OpenEye OEToolkits 1.7.6: c1ccc(cc1)CN2CCC(CC2)(Cc3ccc(cc3)Cl)C(=O)C=C(C(=O)O)O
  CACTVS 3.370: OC(=O)C(O)=CC(=O)C1(CCN(CC1)Cc2ccccc2)Cc3ccc(Cl)cc3
  OpenEye OEToolkits 1.7.6: c1ccc(cc1)CN2CCC(CC2)(Cc3ccc(cc3)Cl)C(=O)/C=C(/C(=O)O)\O
  ACDLabs 12.01: O=C(O)C(\O)=C\C(=O)C2(CCN(Cc1ccccc1)CC2)Cc3ccc(Cl)cc3
  CACTVS 3.370: OC(=O)C(/O)=C/C(=O)C1(CCN(CC1)Cc2ccccc2)Cc3ccc(Cl)cc3
• Formula: C23 H24 Cl N O4
• Name: (2Z)-4-[1-benzyl-4-(4-chlorobenzyl)piperidin-4-yl]-2-hydroxy-4-oxobut-2-enoic acid
• ChEMBL: CHEMBL463590
• ZINC: ZINC000100970611
• PDB chain: 5fdg Chain A Residue 204

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5fdg Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): Y29 H46 E65 L91 E104 K119
• Binding residue (residue number reindexed from 1): Y29 H46 E65 L91 E104 K119
• Annotation score: 1
• Binding affinity: PDBbind-CN: -logKd/Ki=6.37,IC50=0.43uM
  BindingDB: IC50=430nM

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:5fdg, PDBe:5fdg, PDBj:5fdg
• PDBsum: 5fdg
• PubMed: 27088785
• UniProt: P03433|PA_I34A1 Polymerase acidic protein (Gene Name=PA)