Structure of PDB 4qr9 Chain A Binding Site BS03

Receptor Information
>4qr9 Chain A (length=75) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAK
EKGKFEDMAKADKARYEREMKTYIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qr9 Two high-mobility group box domains act together to underwind and kink DNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G5 S6 K7
Binding residue
(residue number reindexed from 1)		G1 S2 K3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4qr9, PDBe:4qr9, PDBj:4qr9
PDBsum4qr9
PubMed26143914
UniProtP63159|HMGB1_RAT High mobility group protein B1 (Gene Name=Hmgb1)

[Back to BioLiP]