Structure of PDB 4oq9 Chain A Binding Site BS03

Receptor Information
>4oq9 Chain A (length=144) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF
RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN
INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oq9 Satellite tobacco mosaic virus refined to 1.4 angstrom resolution.
Resolution1.45 Å
Binding residue
(original residue number in PDB)
V38 A40
Binding residue
(residue number reindexed from 1)
V23 A25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:4oq9, PDBe:4oq9, PDBj:4oq9
PDBsum4oq9
PubMed25195746
UniProtP17574|COAT_STMV Coat protein

[Back to BioLiP]