Structure of PDB 4gnk Chain A Binding Site BS03

Receptor Information
>4gnk Chain A (length=337) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGY
SDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVD
VEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRV
ADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWI
HCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNS
SVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLN
PDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLK
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain4gnk Chain A Residue 403 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gnk Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		S53 T186
Binding residue
(residue number reindexed from 1)		S36 T169
Annotation score1
Enzymatic activity
Catalytic site (original residue number in PDB) E49 T54 R183 D205 Q209
Catalytic site (residue number reindexed from 1) E32 T37 R166 D188 Q192
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0030234 enzyme regulator activity
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity
Biological Process
GO:0001501 skeletal system development
GO:0001508 action potential
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007207 phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007507 heart development
GO:0008217 regulation of blood pressure
GO:0009791 post-embryonic development
GO:0010543 regulation of platelet activation
GO:0016322 neuron remodeling
GO:0021884 forebrain neuron development
GO:0032024 positive regulation of insulin secretion
GO:0042711 maternal behavior
GO:0042733 embryonic digit morphogenesis
GO:0045634 regulation of melanocyte differentiation
GO:0048066 developmental pigmentation
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0086100 endothelin receptor signaling pathway
GO:0099105 ion channel modulating, G protein-coupled receptor signaling pathway
GO:1904888 cranial skeletal system development
GO:1990806 ligand-gated ion channel signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005794 Golgi apparatus
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0031965 nuclear membrane
GO:0044297 cell body
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gnk, PDBe:4gnk, PDBj:4gnk
PDBsum4gnk
PubMed23377541
UniProtP21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha (Gene Name=Gnaq)

[Back to BioLiP]