Structure of PDB 4d8j Chain A Binding Site BS03

Receptor Information
>4d8j Chain A (length=149) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENE
PVLVNGWIDKHMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIV
WQRLAGLAQRRGKTLSETIVQLIEDAENKEKYANKMSSLKQDLQALLGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d8j Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
Resolution3.55 Å
Binding residue
(original residue number in PDB)		R103 R110
Binding residue
(residue number reindexed from 1)		R103 R110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007059 chromosome segregation
GO:0051276 chromosome organization
GO:0051289 protein homotetramerization
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm
GO:0097047 DNA replication termination region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d8j, PDBe:4d8j, PDBj:4d8j
PDBsum4d8j
PubMed23084832
UniProtP0A8N0|MATP_ECOLI Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]