Structure of PDB 4akb Chain A Binding Site BS03

Receptor Information
>4akb Chain A (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGENHKSFITG
FTPVKISLDFPSEYIMEVSGYTGKVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFSLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>4akb Chain F (length=15) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSGISQTVIVGPWGA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4akb Structures and Binding Specificity of Galactose- and Mannose-Binding Lectins from Champedak: Differences from Jackfruit Lectins
Resolution1.95 Å
Binding residue
(original residue number in PDB)		S105 P107 E109 N110 L133
Binding residue
(residue number reindexed from 1)		S105 P107 E109 N110 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4akb, PDBe:4akb, PDBj:4akb
PDBsum4akb
PubMed24915077
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]