Structure of PDB 3o9x Chain A Binding Site BS03

Receptor Information

>3o9x Chain A (length=132) Species: 83333 (Escherichia coli K-12)

HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEE
SDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAF
SRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3o9x Chain A Residue 132

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3o9x Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
• Resolution: 2.0999 Å
• Binding residue (original residue number in PDB): C3 C6 C37 C40
• Binding residue (residue number reindexed from 1): C4 C7 C38 C41
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity
• GO:0043565 sequence-specific DNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0044010 single-species biofilm formation

Cellular Component

• GO:0110001 toxin-antitoxin complex

External links

• PDB: RCSB:3o9x, PDBe:3o9x, PDBj:3o9x
• PDBsum: 3o9x
• PubMed: 21068382
• UniProt: Q46864|MQSA_ECOLI Antitoxin MqsA (Gene Name=mqsA)