Structure of PDB 3mxa Chain A Binding Site BS03

Receptor Information

>3mxa Chain A (length=301) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNKEFLLYLAGFVDGDGSIIAQINPNQSSKFKHRLRLTFYVTQKTQR
RWFLDKLVDEIGVGYVRDSGSVSQYVLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LSNKEFLLYLAGFVDSDGSIIAQIKPRQSNKFKHQLSLTFAVTQKTQRRW
FLDKLVDEIGVGYVYDSGSVSDYRLSEIKPLHNFLTQLQPFLKLKQKQAN
LVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLD
S

Ligand information

>3mxa Chain E (length=14)

tctggctgaggtac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mxa Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): S32 S33 K34 R38 R40 Y66 R68 I81 D211 T237 Q238 K239 R242
• Binding residue (residue number reindexed from 1): S31 S32 K33 R37 R39 Y65 R67 I80 D167 T193 Q194 K195 R198

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 11:38:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3mxa', asym_id = 'A', bs = 'BS03', title = 'Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3mxa', asym_id='A', bs='BS03', title='Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mxa', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mxa', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>