Structure of PDB 3lwi Chain A Binding Site BS03

Receptor Information
>3lwi Chain A (length=58) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRH
KLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lwi Structural insights into the interaction of the crenarchaeal chromatin protein Cren7 with DNA
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K37 P59 I60
Binding residue
(residue number reindexed from 1)		K35 P57 I58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3lwi, PDBe:3lwi, PDBj:3lwi
PDBsum3lwi
PubMed20345658
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]