Structure of PDB 3lm1 Chain A Binding Site BS03

Receptor Information
>3lm1 Chain A (length=133) Species: 3496 (Maclura pomifera) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTFDDGAYTGIREINFEYNSETAIGGLRVTYDLNGMPFVAEDHKSFITG
FKPVKISLEFPSEYIVEVSGYVGKVEGYTVIRSLTFKTNKQTYGPYGVTN
GTPFSLPIENGLIVGFKGSIGYWLDYFSIYLSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lm1 Characterization of the secondary binding sites of Maclura pomifera agglutinin by glycan array and crystallographic analyses.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P107 E109 N110
Binding residue
(residue number reindexed from 1)		P107 E109 N110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0030246 carbohydrate binding

View graph for
Molecular Function
External links
PDB RCSB:3lm1, PDBe:3lm1, PDBj:3lm1
PDBsum3lm1
PubMed20826825
UniProtP18674|LECA_MACPO Agglutinin alpha chain

[Back to BioLiP]