Structure of PDB 3igc Chain A Binding Site BS03

Receptor Information
>3igc Chain A (length=313) Species: 10255 (Variola virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRALFYKDGKLFTDNNFLNPVSDNNPAYEVLQHVKIPTHLTDVVVYGQTW
EEALTRLIFVGSDSKGRRQYFYGKMHVQNRNAKRDRIFVRVYNVMKRINS
FINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLTLKN
KHIEISPDKIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLF
NKLSERKVYESIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKK
LIALTIKQTAEVVGHTPSISKRAYMATTILEMVKDKNFLDVVSKTTFDEF
LSIVVDHVKSSTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3igc Insights from the Structure of a Smallpox Virus Topoisomerase-DNA Transition State Mimic.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		H39 K65 R67 Q69 R130 F131 G132 K133 Y136 N140 T142 K167 D168 R218 K220 K271
Binding residue
(residue number reindexed from 1)		H39 K65 R67 Q69 R130 F131 G132 K133 Y136 N140 T142 K167 D168 R218 K220 K271
Enzymatic activity
Catalytic site (original residue number in PDB) R130 K167 R223 H265 Y274
Catalytic site (residue number reindexed from 1) R130 K167 R223 H265 Y274
Enzyme Commision number 5.6.2.1: DNA topoisomerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003916 DNA topoisomerase activity
GO:0003917 DNA topoisomerase type I (single strand cut, ATP-independent) activity
Biological Process
GO:0006265 DNA topological change
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3igc, PDBe:3igc, PDBj:3igc
PDBsum3igc
PubMed20152159
UniProtP32989|TOP1_VAR67 DNA topoisomerase 1 (Gene Name=OPG111)

[Back to BioLiP]