Structure of PDB 3e54 Chain A Binding Site BS03

Receptor Information
>3e54 Chain A (length=159) Species: 164451 (Vulcanisaeta distributa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEDFKEGYILGFIEAEGSFSVSIKFQRDVFGGVRLDPVFSITQKNREVLE
AIKEHLGIGRIMEKAGQPNTYVYVVDNFNELVKLINFLNKYADFMIVKKR
QFLMFREIANGLVNGEHLHINGLKRLVKLAYELTKESEKGYRKYDLNHVL
SIIDKWDLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e54 Recognition of a common rDNA target site in archaea and eukarya by analogous LAGLIDADG and His-Cys box homing endonucleases
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S21 S23 S25 I26 K27 Q29 R37 K67 K101 T137 S140 K142 G143 Y144 R145 K146
Binding residue
(residue number reindexed from 1)		S18 S20 S22 I23 K24 Q26 R34 K64 K98 T134 S137 K139 G140 Y141 R142 K143
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3e54, PDBe:3e54, PDBj:3e54
PDBsum3e54
PubMed18984620
UniProtQ6L703

[Back to BioLiP]