Structure of PDB 3bxk Chain A Binding Site BS03

Receptor Information
>3bxk Chain A (length=137) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARKSEEEIREAFRVFDKDGNGYISAAELRHV
MTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain3bxk Chain A Residue 150 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bxk Crystal structure of the P/Q-type calcium channel (CaV2.1) IQ domain and CA2+calmodulin complex
Resolution2.55 Å
Binding residue
(original residue number in PDB)
D129 D131 D133 Q135 E140
Binding residue
(residue number reindexed from 1)
D121 D123 D125 Q127 E132
Annotation score4
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V32
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005246 calcium channel regulator activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008179 adenylate cyclase binding
GO:0010856 adenylate cyclase activator activity
GO:0019855 calcium channel inhibitor activity
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0030235 nitric-oxide synthase regulator activity
GO:0031432 titin binding
GO:0031800 type 3 metabotropic glutamate receptor binding
GO:0043539 protein serine/threonine kinase activator activity
GO:0043548 phosphatidylinositol 3-kinase binding
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050998 nitric-oxide synthase binding
GO:0072542 protein phosphatase activator activity
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0001975 response to amphetamine
GO:0002027 regulation of heart rate
GO:0005513 detection of calcium ion
GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0016240 autophagosome membrane docking
GO:0032465 regulation of cytokinesis
GO:0035458 cellular response to interferon-beta
GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
GO:0051592 response to calcium ion
GO:0051649 establishment of localization in cell
GO:0055117 regulation of cardiac muscle contraction
GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0071346 cellular response to type II interferon
GO:0090150 establishment of protein localization to membrane
GO:0090151 establishment of protein localization to mitochondrial membrane
GO:0098901 regulation of cardiac muscle cell action potential
GO:0140056 organelle localization by membrane tethering
GO:0140238 presynaptic endocytosis
GO:1900242 regulation of synaptic vesicle endocytosis
GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering
GO:2000300 regulation of synaptic vesicle exocytosis
Cellular Component
GO:0000922 spindle pole
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005876 spindle microtubule
GO:0008076 voltage-gated potassium channel complex
GO:0030017 sarcomere
GO:0030426 growth cone
GO:0030672 synaptic vesicle membrane
GO:0031514 motile cilium
GO:0031966 mitochondrial membrane
GO:0032991 protein-containing complex
GO:0034704 calcium channel complex
GO:0043209 myelin sheath
GO:0044305 calyx of Held
GO:0097225 sperm midpiece
GO:0098685 Schaffer collateral - CA1 synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol
GO:0150034 distal axon
GO:1902494 catalytic complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3bxk, PDBe:3bxk, PDBj:3bxk
PDBsum3bxk
PubMed
UniProtP0DP29|CALM1_RAT Calmodulin-1 (Gene Name=Calm1)

[Back to BioLiP]