Structure of PDB 3brf Chain A Binding Site BS03

Receptor Information
>3brf Chain A (length=423) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLTSDRMIDFLSNKEKYECVISIFHAKVAQKSYGNEKRFFCPPPCIYLIG
QGWKLKKDRVAQLYKTLTELVAYIGIGSDTSERQQLDFPNIYDYCAAKTL
YISDSDKRKYFDLNAQFFYGCGMEIGGFVSQRIKVISKPSKKKQSDCKYL
CIASGTKVALFNRLRSQTVSTRYLHVEGNAFHASSTKWGAFTIHLFDDEQ
ETDNFAVRDGFVYYGSVVKLVDSVTGIALPRLRIRKVDKQQVILDASCSE
EPVSQLHKCAFQMIDNELVYLCLSHDKIIQHQATAINEHRHQINDGAAWT
IISTDKAEYRFFEAMGQVANPISPCPVVGSLEVDGHGEASRVELHGRDFK
PNLKVWFGATPVETTFRSEESLHCSIPPVSQVRNEQTHWMFTNRTTGDVE
VPISLVRDDGVVYSSGLTFSYKS
Ligand information
>3brf Chain D (length=13) Species: 6239 (Caenorhabditis elegans) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RMINASVWMPPME
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3brf RAM-induced Allostery Facilitates Assembly of a Notch Pathway Active Transcription Complex.
Resolution2.47 Å
Binding residue
(original residue number in PDB)
A414 F415 T439 D440 N441 F442 A443 V444 G463 I464 A465 P467 I515 I516 Q517 H518
Binding residue
(residue number reindexed from 1)
A180 F181 T202 D203 N204 F205 A206 V207 G226 I227 A228 P230 I278 I279 Q280 H281
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Feb 17 13:38:10 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3brf', asym_id = 'A', bs = 'BS03', title = 'RAM-induced Allostery Facilitates Assembly of a Notch Pathway Active Transcription Complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3brf', asym_id='A', bs='BS03', title='RAM-induced Allostery Facilitates Assembly of a Notch Pathway Active Transcription Complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000978,0001228,0003677,0003700,0005634,0006355,0006357', uniprot = '', pdbid = '3brf', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000978,0001228,0003677,0003700,0005634,0006355,0006357', uniprot='', pdbid='3brf', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>