Structure of PDB 2vs8 Chain A Binding Site BS03

Receptor Information
>2vs8 Chain A (length=183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLNPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vs8 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		N32 R33 S34 E35 Y36 R37 S67 K68 Q70 R81 S83 S84 K85 E117 W128 N129 K130 D155 H158 V160
Binding residue
(residue number reindexed from 1)		N28 R29 S30 E31 Y32 R33 S63 K64 Q66 R77 S79 S80 K81 E113 W124 N125 K126 D151 H154 V156
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vs8, PDBe:2vs8, PDBj:2vs8
PDBsum2vs8
PubMed18974222
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]