Structure of PDB 2rve Chain A Binding Site BS03

Receptor Information

>2rve Chain A (length=213) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLRSDLINALYYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIA
EKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFT
LGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRTYNINELNEIPKPYKG
VKVFLQDKWVIAGDLAGSTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRN
YEYNNISEYRNWI

Ligand information

>2rve Chain F (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgagctcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2rve The crystal structure of EcoRV endonuclease and of its complexes with cognate and non-cognate DNA fragments.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	S112 N120
Binding residue (residue number reindexed from 1)	S106 N114

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2rve, PDBe:2rve, PDBj:2rve
PDBsum	2rve
PubMed	8491171
UniProt	P04390\|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]