Structure of PDB 2nq9 Chain A Binding Site BS03

Receptor Information
>2nq9 Chain A (length=279) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTID
EFKAACEKYHYTSAQILPHDSALINLGHPVTEALEKSRDAFIDEMQRCEQ
LGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQ
GSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTF
ADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQD
DRFDGIPLILETINPDIWAEEIAWLKAQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nq9 DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		R37 Q38 W39 A72 L73 N75 Q150 G151 S152 R230
Binding residue
(residue number reindexed from 1)		R37 Q38 W39 A72 L73 N75 Q150 G151 S152 R230
Binding affinityPDBbind-CN: Kd=97nM
Enzymatic activity
Enzyme Commision number 3.1.21.2: deoxyribonuclease IV.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004519 endonuclease activity
GO:0008081 phosphoric diester hydrolase activity
GO:0008270 zinc ion binding
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
GO:0016791 phosphatase activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nq9, PDBe:2nq9, PDBj:2nq9
PDBsum2nq9
PubMed18408731
UniProtP0A6C1|END4_ECOLI Endonuclease 4 (Gene Name=nfo)

[Back to BioLiP]