Structure of PDB 1zr2 Chain A Binding Site BS03

Receptor Information
>1zr2 Chain A (length=183) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDL
LRMKVKEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTD
SYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDA
VLNMWQQGLGASHISKTMNIARSTVYKVINESN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zr2 Structure of a synaptic gamma delta resolvase tetramer covalently linked to two cleaved DNAs.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R142 R144 I146 I170 A171 S173 T174
Binding residue
(residue number reindexed from 1)		R142 R144 I146 I170 A171 S173 T174
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1zr2, PDBe:1zr2, PDBj:1zr2
PDBsum1zr2
PubMed15994378
UniProtP03012|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]