Structure of PDB 1zaw Chain A Binding Site BS03

Receptor Information
>1zaw Chain A (length=178) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VMLTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYG
DGARFRVVKNTLLNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKII
YNFYKDKKADLSRLKGGFLEGKKFTAEEVENIAKLPSKEELYAMLVGRVK
APITGLVFALSGILRNLVYVLNAIKEKK
Ligand information
>1zaw Chain Z (length=27) Species: 2336 (Thermotoga maritima) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TIDEIIEAIEKLTVSELAELVKKLEDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zaw Structural Basis for the Function of the Ribosomal L7/12 Stalk in Factor Binding and GTPase Activation.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N165 L166 V169
Binding residue
(residue number reindexed from 1)		N166 L167 V170
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1zaw, PDBe:1zaw, PDBj:1zaw
PDBsum1zaw
PubMed15989950
UniProtP29394|RL10_THEMA Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]