Structure of PDB 1yyk Chain A Binding Site BS03

Receptor Information
>1yyk Chain A (length=221) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFF
IVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKI
NETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKK
DYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGK
SKKEAEQRAAEELIKLLEESE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yyk Intermediate states of ribonuclease III in complex with double-stranded RNA
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H179 H180
Binding residue
(residue number reindexed from 1)		H179 H180
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004519 endonuclease activity
GO:0004525 ribonuclease III activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yyk, PDBe:1yyk, PDBj:1yyk
PDBsum1yyk
PubMed16216575
UniProtO67082|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]