Structure of PDB 1xo5 Chain A Binding Site BS03

Receptor Information
>1xo5 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSL
PELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYA
FRIFDFDDDGTLNREDLSRLVNCLTRLSASEMKQLIDNILEESDIDRDGT
INLSEFQHVISRSPDFASSFKIVL
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain1xo5 Chain A Residue 7 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xo5 Structural and Biochemical Characterization of CIB1 Delineates a New Family of EF-hand-containing Proteins
Resolution1.99 Å
Binding residue
(original residue number in PDB)		F98 L191
Binding residue
(residue number reindexed from 1)		F87 L174
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008427 calcium-dependent protein kinase inhibitor activity
GO:0030291 protein serine/threonine kinase inhibitor activity
GO:0031267 small GTPase binding
GO:0043495 protein-membrane adaptor activity
GO:0044325 transmembrane transporter binding
GO:0046872 metal ion binding
Biological Process
GO:0001525 angiogenesis
GO:0001933 negative regulation of protein phosphorylation
GO:0001934 positive regulation of protein phosphorylation
GO:0001954 positive regulation of cell-matrix adhesion
GO:0002931 response to ischemia
GO:0006302 double-strand break repair
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007026 negative regulation of microtubule depolymerization
GO:0007113 endomitotic cell cycle
GO:0007155 cell adhesion
GO:0007283 spermatogenesis
GO:0007286 spermatid development
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0010977 negative regulation of neuron projection development
GO:0030154 cell differentiation
GO:0030220 platelet formation
GO:0030307 positive regulation of cell growth
GO:0030335 positive regulation of cell migration
GO:0031122 cytoplasmic microtubule organization
GO:0033630 positive regulation of cell adhesion mediated by integrin
GO:0038163 thrombopoietin-mediated signaling pathway
GO:0042127 regulation of cell population proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043085 positive regulation of catalytic activity
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0051301 cell division
GO:0051302 regulation of cell division
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0071356 cellular response to tumor necrosis factor
GO:0071363 cellular response to growth factor stimulus
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis
GO:0090314 positive regulation of protein targeting to membrane
GO:0097191 extrinsic apoptotic signaling pathway
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1903078 positive regulation of protein localization to plasma membrane
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000256 positive regulation of male germ cell proliferation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030027 lamellipodium
GO:0030424 axon
GO:0030426 growth cone
GO:0031982 vesicle
GO:0032433 filopodium tip
GO:0032587 ruffle membrane
GO:0042383 sarcolemma
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0071944 cell periphery

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xo5, PDBe:1xo5, PDBj:1xo5
PDBsum1xo5
PubMed15574431
UniProtQ99828|CIB1_HUMAN Calcium and integrin-binding protein 1 (Gene Name=CIB1)

[Back to BioLiP]