Structure of PDB 1wr5 Chain A Binding Site BS03

Receptor Information

>1wr5 Chain A (length=108) Species: 883 (Nitratidesulfovibrio vulgaris str. 'Miyazaki F')

AAPKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKKDYQKCATA
GCHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTG
CKGSKCHS

Ligand information

• Ligand ID: HEC
• InChI: InChI=1S/C34H34N4O4.Fe/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,9-12H2,1-6H3,(H,39,40)(H,41,42);/q-4;+4/b21-7?,22-8?,26-13-,29-14-,30-15-,31-16-;
• InChIKey: HXQIYSLZKNYNMH-LJNAALQVSA-N
• SMILES:
  ACDLabs 10.04: O=C(O)CCC1=C(C2=CC6=C(C(=C/C)\C5=CC4=C(C(\C3=Cc7c(c(c8C=C1N2[Fe](N34)(N56)n78)CCC(=O)O)C)=C/C)C)C)C
  OpenEye OEToolkits 1.5.0: CC=C1C(=C2C=C3C(=CC)C(=C4N3[Fe]56N2C1=Cc7n5c(c(c7C)CCC(=O)O)C=C8N6C(=C4)C(=C8CCC(=O)O)C)C)C
  CACTVS 3.341: C\C=C1/C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)\C7=C/C)C=C1N2[Fe@@]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
  CACTVS 3.341: CC=C1C(=C2C=C3N4C(=Cc5n6c(C=C7N8C(=C(C)C7=CC)C=C1N2[Fe]468)c(C)c5CCC(O)=O)C(=C3C)CCC(O)=O)C
• Formula: C34 H34 Fe N4 O4
• Name: HEME C
• PDB chain: 1wr5 Chain A Residue 1001

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1wr5 Role of the aromatic ring of Tyr43 in tetraheme cytochrome c(3) from Desulfovibrio vulgaris Miyazaki F.
• Resolution: 1.4 Å
• Binding residue (original residue number in PDB): P2 K3 P5 L9 M11 F20 H22 V28 C30 C33 H34 Y43 K45 C46
• Binding residue (residue number reindexed from 1): P3 K4 P6 L10 M12 F21 H23 V29 C31 C34 H35 Y44 K46 C47
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding

External links

• PDB: RCSB:1wr5, PDBe:1wr5, PDBj:1wr5
• PDBsum: 1wr5
• PubMed: 14581238
• UniProt: P00132|CYC3_NITV9 Cytochrome c3 (Gene Name=DvMF_2499)