Structure of PDB 1u8b Chain A Binding Site BS03

Receptor Information
>1u8b Chain A (length=132) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYA
NASEALAAGFRPCKRCQPDKANPRQHRLDKITHACRLLEQETPVTLEALA
DQVAMSPFHLHRLFKATTGMTPKAWQQAWRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u8b A methylation-dependent electrostatic switch controls DNA repair and transcriptional activation by E. coli ada.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T101 H117 T127 K129
Binding residue
(residue number reindexed from 1)		T95 H111 T121 K123
Enzymatic activity
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
2.1.1.n11: methylphosphotriester-DNA--[protein]-cysteine S-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008168 methyltransferase activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1u8b, PDBe:1u8b, PDBj:1u8b
PDBsum1u8b
PubMed16209950
UniProtP06134|ADA_ECOLI Bifunctional transcriptional activator/DNA repair enzyme Ada (Gene Name=ada)

[Back to BioLiP]