Structure of PDB 1rc7 Chain A Binding Site BS03

Receptor Information

>1rc7 Chain A (length=220) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFF
IVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKI
NETIIGDVFKALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKK
DYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGK
SKKEAEQRAAEELIKLLEES

Ligand information

>1rc7 Chain D (length=10) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcgcgcgcc

..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rc7 Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA.
Resolution	2.15 Å
Binding residue (original residue number in PDB)	N61 R63 F66 D151 K153 T154 Q157 R167 K203
Binding residue (residue number reindexed from 1)	N61 R63 F66 D151 K153 T154 Q157 R167 K203

Enzymatic activity

Enzyme Commision number

3.1.26.3: ribonuclease III.

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003725	double-stranded RNA binding
GO:0004519	endonuclease activity
GO:0004525	ribonuclease III activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0006397	mRNA processing
GO:0008033	tRNA processing
GO:0010468	regulation of gene expression

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1rc7, PDBe:1rc7, PDBj:1rc7
PDBsum	1rc7
PubMed	15016361
UniProt	O67082\|RNC_AQUAE Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]