Structure of PDB 1owf Chain A Binding Site BS03

Receptor Information
>1owf Chain A (length=96) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGN
FDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1owf Integration Host Factor: putting a twist on protein-DNA recognition
Resolution1.95 Å
Binding residue
(original residue number in PDB)		T4 K5 K57 R60 R63 N64 P65 K66 I71 I73 R76
Binding residue
(residue number reindexed from 1)		T3 K4 K56 R59 R62 N63 P64 K65 I70 I72 R75
Binding affinityPDBbind-CN: Kd=4.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1owf, PDBe:1owf, PDBj:1owf
PDBsum1owf
PubMed12842466
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA)

[Back to BioLiP]