Structure of PDB 1oup Chain A Binding Site BS03

Receptor Information

>1oup Chain A (length=213) Species: 672 (Vibrio vulnificus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

APPSSFSAAKQQAVKIYQDHPISFYCGCDIEWQGKKGIPNLETCGYQVRK
QQTRASRIEWEAVVPAWQFGHHRQCWQKGGRKNCSKNDQQFRLMEADLHN
LTPAIGEVNGDRSNFNFSQWNGVDGVSYGRCEMQVNFKQRKVMPPDRARG
SIARTYLYMSQEYGFQLSKQQQQLMQAWNKSYPVDEWECTRDDRIAKIQG
NHNPFVQQSCQTQ

Ligand information

>1oup Chain F (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcgatcgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1oup DNA binding and cleavage by the periplasmic nuclease Vvn: a novel structure with a known active site.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R67 Q69 K100 F155
Binding residue (residue number reindexed from 1)	R49 Q51 K82 F137

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0004518	nuclease activity
GO:0004519	endonuclease activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:1oup, PDBe:1oup, PDBj:1oup
PDBsum	1oup
PubMed	12881435
UniProt	Q7MHK3

[Back to BioLiP]