Structure of PDB 1gdt Chain A Binding Site BS03

Receptor Information
>1gdt Chain A (length=183) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRLFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDL
LRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVSIRFIDDGISTD
GEMGKMVVTILSAVAQAERQRILERTNEGRQEAMAKGVVFGRKRKIDRDA
VLNMWQQGLGASHISKTMNIARSTVYKVINESN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gdt Crystal structure of the site-specific recombinase gamma delta resolvase complexed with a 34 bp cleavage site.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		F140 G141 R142 R144 K145 I146 R148 A171 S173 T174 K177
Binding residue
(residue number reindexed from 1)		F140 G141 R142 R144 K145 I146 R148 A171 S173 T174 K177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gdt, PDBe:1gdt, PDBj:1gdt
PDBsum1gdt
PubMed7628011
UniProtP03012|TNR1_ECOLI Transposon gamma-delta resolvase (Gene Name=tnpR)

[Back to BioLiP]