Structure of PDB 1fiu Chain A Binding Site BS03

Receptor Information

>1fiu Chain A (length=286) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQPLFTQERRIFHKKLLDGNILATNNRGVVSNADGSNTRSFNIAKGIADL
LHSETVSERLPGQTSGNAFEAICSEFVQSAFEKLQHIRPGDWNVKQVGSR
NRLEIARYQQYAHLTALAKAAEENPELAAALGSDYTITPDIIVTRNLIAD
AEINRNEFLVDENIATYASLRAGNGNMPLLHASISCKWTIRSDRAQNARS
EGLNLVRNRKGRLPHIVVVTAEPTPSRISSIALGTGEIDCVYHFALYELE
QILQSLNYEDALDLFYIMVNGKRLKDISDLPLDLAV

Ligand information

>1fiu Chain J (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccggcgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1fiu Structure of the tetrameric restriction endonuclease NgoMIV in complex with cleaved DNA.
Resolution	1.6 Å
Binding residue (original residue number in PDB)	D34 S36 R59 G62 G66 D140 K187 W188 T189 R191 R194
Binding residue (residue number reindexed from 1)	D34 S36 R59 G62 G66 D140 K187 W188 T189 R191 R194

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1fiu, PDBe:1fiu, PDBj:1fiu
PDBsum	1fiu
PubMed	10966652
UniProt	P31032\|T2M4_NEIGO Type II restriction enzyme NgoMIV (Gene Name=ngoMIVR)

[Back to BioLiP]