Structure of PDB 1cw0 Chain A Binding Site BS03

Receptor Information
>1cw0 Chain A (length=155) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPD
FVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDI
SRLQELGWRVLIVWECALRGREKLTDEALTERLEEWICGEGASAQIDTQG
IHLLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cw0 Recognition of a TG mismatch: the crystal structure of very short patch repair endonuclease in complex with a DNA duplex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H5 K12 N13 I17 A18 T19 T22 I24 G65 F67 W68 H69 N93
Binding residue
(residue number reindexed from 1)		H4 K11 N12 I16 A17 T18 T21 I23 G64 F66 W67 H68 N92
Enzymatic activity
Catalytic site (original residue number in PDB) D51 T63 H69 D97
Catalytic site (residue number reindexed from 1) D50 T62 H68 D96
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
GO:0043765 T/G mismatch-specific endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006298 mismatch repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cw0, PDBe:1cw0, PDBj:1cw0
PDBsum1cw0
PubMed10612397
UniProtP09184|VSR_ECOLI DNA mismatch endonuclease Vsr (Gene Name=vsr)

[Back to BioLiP]