Structure of PDB 1cqt Chain A Binding Site BS03

Receptor Information
>1cqt Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFE
ALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPT
SEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
Ligand information
>1cqt Chain I (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARPYQGVRVKEPVKELLRRKRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L6 L53 L55 K155 R158
Binding residue
(residue number reindexed from 1)		L5 L52 L54 K128 R131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
PDBsum1cqt
PubMed10541551
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]