Structure of PDB 7jss Chain 8 Binding Site BS03

Receptor Information
>7jss Chain 8 (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEY
YKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTE
KKARRPTRPTRASKERRLASKAQKSSVKAMRG
Ligand information
>7jss Chain 5 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jss ArfB can displace mRNA to rescue stalled ribosomes.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		G26 Q28 H29 R78 L82
Binding residue
(residue number reindexed from 1)		G25 Q27 H28 R77 L81
Enzymatic activity
Enzyme Commision number 3.1.1.29: peptidyl-tRNA hydrolase.
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0016787 hydrolase activity
GO:0043022 ribosome binding
Biological Process
GO:0006415 translational termination
GO:0006417 regulation of translation
GO:0072344 rescue of stalled ribosome
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jss, PDBe:7jss, PDBj:7jss
PDBsum7jss
PubMed33144582
UniProtP40711|ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB (Gene Name=arfB)

[Back to BioLiP]