Structure of PDB 7oj0 Chain 6 Binding Site BS03

Receptor Information
>7oj0 Chain 6 (length=46) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRYQHTKGQIKDNAIEALLHDPLFRQRVEKNKKGKGSYMRKGKHG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oj0 Structural basis of l-tryptophan-dependent inhibition of release factor 2 by the TnaC arrest peptide.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Q27 R28 V29
Binding residue
(residue number reindexed from 1)		Q27 R28 V29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0072344 rescue of stalled ribosome

View graph for
Biological Process
External links
PDB RCSB:7oj0, PDBe:7oj0, PDBj:7oj0
PDBsum7oj0
PubMed34403461
UniProtP36675|ARFA_ECOLI Alternative ribosome-rescue factor A (Gene Name=arfA)

[Back to BioLiP]