Structure of PDB 6q98 Chain 5 Binding Site BS03

Receptor Information
>6q98 Chain 5 (length=150) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRD
GEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYT
VVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR
Ligand information
>6q98 Chain 4 (length=363) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggcugauucuggauucgacgggauuugcgaaacccaaggugcaugccg
aggggcgguuggccucguaaaaagccgcaaaaaauagucgcaaacgacga
aaacuacgcuuuagcagcuuaauaaccugcuuagagcccucucucccuag
ccuccgcucuuaggacggggaucaagagaggucaaacccaaaagagaucg
cguggaagcccugccugggguugaagcguuaaaacuuaaucaggcuaguu
uguuaguggcguguccguccgcagcuggcaagcgaauguaaagacugacu
aagcauguaguaccgaggauguaggaauuucggacgcggguucaacuccc
gccagcuccacca
<<<<<<<.............<<<<<<<<.......<<..<<<......<<
<<...((((....>>>>......)))).......................
.......<<<<<<<<<<.........>>>>.>>>>>><<<<<<.<<<...
<<<..[(((((>>>...>>>.....>>>>>>..........))))).].<
<<<...<<<<...((...>>>>...>>>>.............)).....<
<<<<....<<...((.....>>....>>>>.>..............))..
...........>>>..>>......>>>>>>>>...<<<<<.......>>>
>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q98 How a circularized tmRNA moves through the ribosome.
Resolution4.3 Å
Binding residue
(original residue number in PDB)		E31 G33 L34 L36 G38 W39 E40 V41 K42 R45 Y55 L57 A74 V75 S77 K89 L91 L92 N93 Q94 E96 N105 G108 Y109 T110 W122 K124 K134
Binding residue
(residue number reindexed from 1)		E21 G23 L24 L26 G28 W29 E30 V31 K32 R35 Y45 L47 A64 V65 S67 K79 L81 L82 N83 Q84 E86 N95 G98 Y99 T100 W112 K114 K124
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 03:15:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6q98', asym_id = '5', bs = 'BS03', title = 'How a circularized tmRNA moves through the ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6q98', asym_id='5', bs='BS03', title='How a circularized tmRNA moves through the ribosome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723', uniprot = '', pdbid = '6q98', asym_id = '5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723', uniprot='', pdbid='6q98', asym_id='5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>