Structure of PDB 8rct Chain 4 Binding Site BS03

Receptor Information

>8rct Chain 4 (length=68) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNIPG

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 8rct Chain 4 Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8rct Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Resolution: 5.32 Å
• Binding residue (original residue number in PDB): C18 C37 C40
• Binding residue (residue number reindexed from 1): C18 C37 C40
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rct, PDBe:8rct, PDBj:8rct
• PDBsum: 8rct
• PubMed: 38409277
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)