Structure of PDB 8inf Chain 3 Binding Site BS03

Receptor Information
>8inf Chain 3 (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPENLLKKRKAYQALKATQAKQALLAKKEQKLRFKRLESFLHDSWRQKR
DKVRLRRLEVKPHLPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFS
GVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPL
TDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHA
TKNRVGFLKEMGTPGYRGERINQLIRQLN
Ligand information
>8inf Chain x (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuucuuuuuuuuuuuuuuu
uuuuuuu
..................................................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8inf Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		W69 P85
Binding residue
(residue number reindexed from 1)		W46 P62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001825 blastocyst formation
Cellular Component
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8inf, PDBe:8inf, PDBj:8inf
PDBsum8inf
PubMed37491604
UniProtQ6DKI1|RL7L_HUMAN Ribosomal protein uL30-like (Gene Name=RPL7L1)

[Back to BioLiP]