Structure of PDB 6ucq Chain 2s Binding Site BS03

Receptor Information

>6ucq Chain 2s (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAV
YNGKQHVPVYITENMVGHKLGEFAPTRTYRGHG

Ligand information

InChI=1S/Mg/q+2

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Mg

Name

MAGNESIUM ION

PDB chain

6ucq Chain 2s Residue 103 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ucq Structural basis for ribosome recycling by RRF and tRNA.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	L15 L16
Binding residue (residue number reindexed from 1)	L14 L15
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ucq, PDBe:6ucq, PDBj:6ucq
PDBsum	6ucq
PubMed	31873307
UniProt	Q5SHP2\|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]