Structure of PDB 7jqm Chain 2m Binding Site BS03

Receptor Information
>7jqm Chain 2m (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAE
VVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
TRTNARTRKGPRKTVAGKKKAP
Ligand information
>7jqm Chain 2x (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcagccugguagcucgucgggcucauaacccgaaggucgu
cgguucaaauccggcccccgcaacca
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jqm Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		A118 G119
Binding residue
(residue number reindexed from 1)		A116 G117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jqm, PDBe:7jqm, PDBj:7jqm
PDBsum7jqm
PubMed32787108
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]