Structure of PDB 8uvr Chain 20 Binding Site BS03

Receptor Information
>8uvr Chain 20 (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPL
Ligand information
>8uvr Chain 2x (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcagccugguagcucgucgggcucauaacccgaaggucgu
cgguucaaauccggcccccgcaacca
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uvr Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K4 L7 G8 R11
Binding residue
(residue number reindexed from 1)		K3 L6 G7 R10
External links
PDB RCSB:8uvr, PDBe:8uvr, PDBj:8uvr
PDBsum8uvr
PubMed38165935
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]