Structure of PDB 6cfl Chain 1y Binding Site BS03

Receptor Information

>6cfl Chain 1y (length=97) Species: 300852 (Thermus thermophilus HB8)

TMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVAD
ATINTPNGVLVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAA

Ligand information

• Ligand ID: MG
• InChI: InChI=1S/Mg/q+2
• InChIKey: JLVVSXFLKOJNIY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Mg+2]
  CACTVS 3.341: [Mg++]
• Formula: Mg
• Name: MAGNESIUM ION
• DrugBank: DB01378
• PDB chain: 6cfl Chain 1y Residue 3002

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6cfl Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): N4 I5
• Binding residue (residue number reindexed from 1): N3 I4
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0043024 ribosomal small subunit binding

Biological Process

• GO:0006417 regulation of translation
• GO:0009409 response to cold
• GO:0022611 dormancy process
• GO:0044238 primary metabolic process
• GO:0045900 negative regulation of translational elongation
• GO:0045947 negative regulation of translational initiation

Cellular Component

• GO:0005829 cytosol
• GO:0022627 cytosolic small ribosomal subunit

External links

• PDB: RCSB:6cfl, PDBe:6cfl, PDBj:6cfl
• PDBsum: 6cfl
• PubMed: 29410130
• UniProt: P0AD49|YFIA_ECOLI Ribosome-associated inhibitor A (Gene Name=raiA)