Structure of PDB 8ugp Chain 1C Binding Site BS03

Receptor Information

>8ugp Chain 1C (length=53) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTWYEIDMRILTGYGFHPFRKFPLSGYVELRYDRVVAEPVELAQEFRKFD
LNS

Ligand information

>8ugp Chain 1W (length=4) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KQTH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ugp High-resolution in situ structures of mammalian respiratory supercomplexes.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y155 V183
Binding residue (residue number reindexed from 1)	Y14 V35

Gene Ontology

	Molecular Function
GO:0003954	NADH dehydrogenase activity
GO:0008137	NADH dehydrogenase (ubiquinone) activity

	Biological Process
GO:0006120	mitochondrial electron transport, NADH to ubiquinone
GO:0032981	mitochondrial respiratory chain complex I assembly
GO:0072593	reactive oxygen species metabolic process
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016604	nuclear body
GO:0031966	mitochondrial membrane
GO:0045271	respiratory chain complex I

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ugp, PDBe:8ugp, PDBj:8ugp
PDBsum	8ugp
PubMed	38811722
UniProt	A0A286ZNN4

[Back to BioLiP]