Structure of PDB 8vtu Chain 10 Binding Site BS03

Receptor Information
>8vtu Chain 10 (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPL
Ligand information
>8vtu Chain 1x (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vtu Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
A2 G6 L7 R11
Binding residue
(residue number reindexed from 1)
A1 G5 L6 R10
External links
PDB RCSB:8vtu, PDBe:8vtu, PDBj:8vtu
PDBsum8vtu
PubMed39039256
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]