Structure of PDB 8i0w Chain z Binding Site BS02

Receptor Information
>8i0w Chain z (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARNAEKAMTALARFRQAQLEEPFLASECTELPKAEKWRRQIIGEISKKVA
QIQNAGLGEFRIRDLNDEINKLLREKGHWE
Ligand information
>8i0w Chain H (length=139) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgcuucucggccuuuuggcuaagaucaaguguaguaucuguucuuuua
auauguccucuaccgaggacaauauuaaggauuuuuggagcagggagcca
cgcaucgaccugguauugcaguaccuccaggaacggugc
...............................................<<<
<<<<<<<<<<....>>>>>>.>>>>>>>...............<......
><<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0w Molecular basis for the activation of human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)
A11 R14
Binding residue
(residue number reindexed from 1)
A10 R13
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:0071020 post-spliceosomal complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum8i0w
PubMed39068178
UniProtQ9ULR0|ISY1_HUMAN Pre-mRNA-splicing factor ISY1 homolog (Gene Name=ISY1)

[Back to BioLiP]