Structure of PDB 6s05 Chain z Binding Site BS02

Receptor Information
>6s05 Chain z (length=58) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRTITAADRRMVSGVTEKQYKKGMKKMQQLEKNAINTQIRREIKRVNFQT
HYRDELLQ
Ligand information
>6s05 Chain y (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucau
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s05 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		V386 S387 G388
Binding residue
(residue number reindexed from 1)		V12 S13 G14
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s05, PDBe:6s05, PDBj:6s05
PDBsum6s05
PubMed31115337
UniProtQ06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 (Gene Name=REH1)

[Back to BioLiP]