Structure of PDB 9c4g Chain y Binding Site BS02

Receptor Information
>9c4g Chain y (length=58) Species: 1747 (Cutibacterium acnes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKLKITQIKSGIATKPNHRETLRSLGLKRIGDTVIKEDRPEFRGMVRTV
RHLVTMEE
Ligand information
>9c4g Chain b (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuccgguggccauaguggaagggaaacacccggucccauuccgaacccg
gucguuaagccuuccaacgcugaugguacugcacgagggaucguguggga
gaguaagacgcugccggaau
.<<<<<<<<<<....<<<<<<<<.....<<<<<<.............>>>
>..>>....>>>>>>.>>.<<.......<<<<<<<<....>>>>>>>>..
.....>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.
Resolution2.53 Å
Binding residue
(original residue number in PDB)		K17 R52 H53
Binding residue
(residue number reindexed from 1)		K16 R51 H52
External links