Structure of PDB 8crx Chain y Binding Site BS02

Receptor Information
>8crx Chain y (length=58) Species: 1747 (Cutibacterium acnes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKLKITQIKSGIATKPNHRETLRSLGLKRIGDTVIKEDRPEFRGMVRTV
RHLVTMEE
Ligand information
>8crx Chain b (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuccgguggccauaguggaagggaaacacccggucccauuccgaacccg
gucguuaagccuuccaacgcugaugguacugcacgagggaucguguggga
gaguaagacgcugccggaau
.<<<<<<<<<<....<<<<<<<<.....<<<<<...............>>
>..>>....>>>>>>.>>.<<.......<<<<<<<<....>>>>>>>>..
.....>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8crx Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.
Resolution2.78 Å
Binding residue
(original residue number in PDB)		K17 R52 H53
Binding residue
(residue number reindexed from 1)		K16 R51 H52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8crx, PDBe:8crx, PDBj:8crx
PDBsum8crx
PubMed36864821
UniProtA0A2B7I5Y4

[Back to BioLiP]