Structure of PDB 7pkt Chain y Binding Site BS02

Receptor Information
>7pkt Chain y (length=71) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATPKKKLSLHRRGNRRVWYWLKRKTEVAKCSYCGALSGRNQMFSGAAGNS
ACTGQCVEQAPTPPASSYPAE
Ligand information
>7pkt Chain 6 (length=136) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agucauagguagcagaacguucuggaacaauuacgcugaaaacaguaaca
gaauugaagcugcuaacauaaguaacacuaaauggauaacauggccguaa
gcccaagguuuugcauaacaaacagugaauacgguu
...................<<<<<............<<....>>....>>
>>>............................<<<.....>>>........
...........<<.........>>............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		P50 K53 L54 R59 R62 R63 A93
Binding residue
(residue number reindexed from 1)		P3 K6 L7 R12 R15 R16 A46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum7pkt
PubMed34887394
UniProtA8JGW4

[Back to BioLiP]