Structure of PDB 5mq0 Chain y Binding Site BS02

Receptor Information
>5mq0 Chain y (length=83) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISYDQLAKLSYEKTLRNLATQKVQKDTKTGKITIADDDKLVNKLAVSLQS
ESKKRYEARKRQMQNASFINDKNKQFNEKLSRE
Ligand information
>5mq0 Chain 6 (length=99) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuuau
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mq0 Structure of a spliceosome remodelled for exon ligation.
Resolution4.17 Å
Binding residue
(original residue number in PDB)		Y97 L100 K107 R110 S172 R175 Y176 R179 K199
Binding residue
(residue number reindexed from 1)		Y3 L6 K13 R16 S52 R55 Y56 R59 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071008 U2-type post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mq0, PDBe:5mq0, PDBj:5mq0
PDBsum5mq0
PubMed28076345
UniProtP53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)

[Back to BioLiP]